Home » CPSF2 » CPSF2 Proteins » Recombinant Human CPSF2 Protein

Recombinant Human CPSF2 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human CPSF2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 683-782 of Human CPSF2

Source: Wheat Germ

Amino Acid Sequence: FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPSF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPSF2 Protein

  • cleavage and polyadenylation specific factor 2, 100kDa
  • Cleavage and polyadenylation specificity factor 100 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 2
  • CPSF 100 kDa subunit
  • CPSF 100kDa subunit
  • CPSF100
  • KIAA1367cleavage and polyadenylation specific factor 2, 100kD subunit

Background

CPSF2 - cleavage and polyadenylation specific factor 2, 100kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CPSF73 Antibody
(6E6)
H00051692-M01
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: CPSF73 Antibody (6E6) [H00051692-M01] - Analysis of monoclonal antibody to CPSF3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in PC-12.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
INTS11 Antibody
NB100-60638
Western Blot: INTS11 Antibody [NB100-60638] - Detection of Human and Mouse INT11 by Western Blot. Samples: Whole cell lysate from HeLa (15 ug), 293T (50 ug), mouse TCMK-1 (50 ug), and mouse NIH3T3 (50 ug) cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-INT11 antibody NB100-60638 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: INTS11 Antibody [NB100-60638] - Human breast carcinoma. Antibody used at a dilution of 1:1,000.
Western Blot: INTS11 Antibody [NB100-60638] - analysis of INTS11 in HeLa whole cell extracts (samples treated with siCtrl or siINTS11) using anti-INTS11 antibody. Image from verified customer review.
(1 Review)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Cyclophilin A
Antibody [Unconjugate
AF3589
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Staining in human cerebral cortex and pancreas tissues using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same tissues.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell line SH-SY5Y.
(4 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PPIL1 Antibody
NBP2-57062
Western Blot: PPIL1 Antibody [NBP2-57062] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: PPIL1 Antibody [NBP2-57062] - Staining of human cell line SK-MEL-30 shows localization to nucleoli.
Species: Hu
Applications: WB, ICC/IF
Symplekin Antibody
NB100-74592
Western Blot: Symplekin Antibody [NB100-74592] - Detection of Human Symplekin on HeLa whole cell lysate using NB100-74592. Symplekin was also immunoprecipitated by rabbit anti-Symplekin antibodies NB100-74590 and NB100-74591.
Immunohistochemistry: Symplekin Antibody [NB100-74592] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- Symplekin used at a dilution of 1:200 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: Symplekin Antibody [NB100-74592] - FFPE section of human colon carcinoma. Affinity purified rabbit anti-Symplekin used at a dilution of 1:250. Detection: DAB staining using Immunohistochemistry Accessory Kit
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
PPIL2 Antibody
NBP1-85360
Western Blot: PPIL2 Antibody [NBP1-85360] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PPIL2 Antibody [NBP1-85360] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PPIL2 Antibody [NBP1-85360] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communication, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CSTF2 Antibody
NBP1-87407
Western Blot: CSTF2 Antibody [NBP1-87407] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CSTF2 Antibody [NBP1-87407] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CSTF2 Antibody [NBP1-87407] - Staining of human testis shows high expression.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DHX16 Antibody
NBP2-13920
Immunocytochemistry/Immunofluorescence: DHX16 Antibody [NBP2-13920] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining in human testis and liver tissues using anti-DHX16 antibody. Corresponding DHX16 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DHX16 Antibody [NBP2-13920] - Staining of human kidney shows strong nuclear positivity in renal tubules and glomeruli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
TUSC2 Antibody
NBP1-36999
TUSC2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA
PDAP1 Knockout
293T Cell Lysate
NBP2-65749
PDAP1 Knockout 293T Cell Lysate
Species: Hu
HBsAg Antibody
(3E7)
NBP1-22568
Immunohistochemistry-Paraffin: HBsAg Antibody (3E7) [NBP1-22568] - Human liver.
(1 Publication)
Species: Hu
Applications: IHC-P
SLBP Antibody
(2C4-1C8)
H00007884-M01
Western Blot: SLBP Antibody (2C4-1C8) [H00007884-M01] - SLBP monoclonal antibody (M01), clone 2C4-1C8 Analysis of SLBP expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: SLBP Antibody (2C4-1C8) [H00007884-M01] - Analysis of monoclonal antibody to SLBP on HeLa cell. Antibody concentration 10 ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
PAPOLA Knockout
293T Cell Lysate
NBP2-65899
PAPOLA Knockout 293T Cell Lysate
Species: Hu
DNAM-1/CD226
Antibody
NBP1-85001
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human small intestine shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: DNAM-1/CD226 Antibody [NBP1-85001] - Staining of human spleen shows moderate positivity in lymphoid cells.
Species: Hu
Applications: IHC, IHC-P
CPSF1 Antibody
NB100-79822
Western Blot: CPSF1 Antibody [NB100-79822] - Detection of Human and Mouse CPSF160 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-CPSF160 antibody NB100-79822 used for WB at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. CPSF160 was also immunoprecipitated by rabbit another anti-CPSF160 antibody, which recognizes an upstream epitope.
Immunocytochemistry/Immunofluorescence: CPSF1 Antibody [NB100-79822] - FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-CPSF160 used at a dilution of 1:100. Detection: Red-fluorescent goat anti-rabbit IgG highly cross-adsorbed Antibody Hilyte PlusTM 555 used at a dilution of 1:100.
Immunohistochemistry-Paraffin: CPSF1 Antibody [NB100-79822] - Human ovarian carcinoma (left) and mouse renal cell carcinoma (right). Antibody used at a dilution of 1:200 (1ug/ml).
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for CPSF2 Partial Recombinant Protein (H00053981-Q01) (0)

There are no publications for CPSF2 Partial Recombinant Protein (H00053981-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF2 Partial Recombinant Protein (H00053981-Q01) (0)

There are no reviews for CPSF2 Partial Recombinant Protein (H00053981-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPSF2 Partial Recombinant Protein (H00053981-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPSF2 Products

Bioinformatics Tool for CPSF2 Partial Recombinant Protein (H00053981-Q01)

Discover related pathways, diseases and genes to CPSF2 Partial Recombinant Protein (H00053981-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF2 Partial Recombinant Protein (H00053981-Q01)

Discover more about diseases related to CPSF2 Partial Recombinant Protein (H00053981-Q01).

PTMs for CPSF2 Partial Recombinant Protein (H00053981-Q01)

Learn more about PTMs related to CPSF2 Partial Recombinant Protein (H00053981-Q01).

Blogs on CPSF2

There are no specific blogs for CPSF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human CPSF2 Protein
H00053981-P01-10ug
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Reg3A Antibody
NBP2-24763
Western Blot: CPSF2 Antibody [NB100-79823] - Detection of CPSF2 from Hela whole cell lysate (5, 15, 50 microgram), 293T (T; 50 microgram) and mouse NIH3T3 (M; 50 microgram). CPSF100 was also immunoprecipitated by rabbit anti-CPSF100 antibodies NB100-79824 and NB100-79825.
CPSF2 Antibody
NB100-79823
Western Blot: INTS11 Antibody [NB100-60638] - Detection of Human and Mouse INT11 by Western Blot. Samples: Whole cell lysate from HeLa (15 ug), 293T (50 ug), mouse TCMK-1 (50 ug), and mouse NIH3T3 (50 ug) cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-INT11 antibody NB100-60638 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
INTS11 Antibody
NB100-60638

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPSF2 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CPSF2