Recombinant Human CPSF2 Protein

SDS-Page: Recombinant Human CPSF2 Protein [H00053981-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, PAGE, AP

Recombinant Human CPSF2 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 683-782 of Human CPSF2
  
  

  Source: Wheat Germ

  Amino Acid Sequence: FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CPSF2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPSF2 Protein

• cleavage and polyadenylation specific factor 2, 100kDa
• Cleavage and polyadenylation specificity factor 100 kDa subunit
• cleavage and polyadenylation specificity factor subunit 2
• CPSF 100 kDa subunit
• CPSF 100kDa subunit
• CPSF100
• KIAA1367cleavage and polyadenylation specific factor 2, 100kD subunit

Background

CPSF2 - cleavage and polyadenylation specific factor 2, 100kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CPSF2