CPR8 Antibody - BSA Free

Immunohistochemistry-Paraffin: CPR8 Antibody [NBP1-87954] - Staining of human cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: CPR8 Antibody [NBP1-87954] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CPR8 Antibody [NBP1-87954] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: CPR8 Antibody [NBP1-87954] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPR8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPR8 Antibody - BSA Free (NBP1-87954) is a polyclonal antibody validated for use in IHC. Anti-CPR8 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCPG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 26230923). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CPR8 Protein (NBP1-87954PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CPR8 Antibody - BSA Free

• CCP8
• cell cycle progression 1
• cell cycle progression protein 1
• cell cycle progression restoration protein 8
• CPR8
• FLJ60574
• KIAA1254

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPR8 Antibody (NBP1-87954)(2)

Publications using NBP1-87954

• Baras AS, Gandhi N, Munari E et al. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. PLoS One 2015-01-01 [PMID: 26230923] (IF/IHC, Human)
• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CCPG1