CPR8 Antibody

Images

 
Immunohistochemistry: CPR8 Antibody [NBP1-87954] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPR8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCPG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPR8 Protein (NBP1-87954PEP)
Publications
Read Publications using
NBP1-87954 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPR8 Antibody

  • CCP8
  • cell cycle progression 1
  • cell cycle progression protein 1
  • cell cycle progression restoration protein 8
  • CPR8
  • FLJ60574
  • KIAA1254

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-58983
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NLS7401
Species: Hu, Mu, Rt, Bt, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-87954
Species: Hu
Applications: IHC, IHC-P

Publications for CPR8 Antibody (NBP1-87954)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for CPR8 Antibody (NBP1-87954) (0)

There are no reviews for CPR8 Antibody (NBP1-87954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CPR8 Antibody (NBP1-87954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPR8 Products

Bioinformatics Tool for CPR8 Antibody (NBP1-87954)

Discover related pathways, diseases and genes to CPR8 Antibody (NBP1-87954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPR8 Antibody (NBP1-87954)

Discover more about diseases related to CPR8 Antibody (NBP1-87954).
 

Pathways for CPR8 Antibody (NBP1-87954)

View related products by pathway.

Research Areas for CPR8 Antibody (NBP1-87954)

Find related products by research area.

Blogs on CPR8

There are no specific blogs for CPR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPR8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCPG1