Recombinant Human CPA3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CPA3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CPA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPA3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPA3 Protein

  • carboxypeptidase A3 (mast cell)
  • Carboxypeptidase A3
  • EC 3.4.17
  • EC 3.4.17.1
  • mast cell carboxypeptidase A
  • MC-CPA

Background

CPA3 - carboxypeptidase A3 (mast cell)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4099
Species: Hu
Applications: WB, IP
NBP1-85494
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP2-26444
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CPA3 Partial Recombinant Protein (H00001359-Q01) (0)

There are no publications for CPA3 Partial Recombinant Protein (H00001359-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPA3 Partial Recombinant Protein (H00001359-Q01) (0)

There are no reviews for CPA3 Partial Recombinant Protein (H00001359-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPA3 Partial Recombinant Protein (H00001359-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPA3 Products

Bioinformatics Tool for CPA3 Partial Recombinant Protein (H00001359-Q01)

Discover related pathways, diseases and genes to CPA3 Partial Recombinant Protein (H00001359-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPA3 Partial Recombinant Protein (H00001359-Q01)

Discover more about diseases related to CPA3 Partial Recombinant Protein (H00001359-Q01).
 

Pathways for CPA3 Partial Recombinant Protein (H00001359-Q01)

View related products by pathway.

PTMs for CPA3 Partial Recombinant Protein (H00001359-Q01)

Learn more about PTMs related to CPA3 Partial Recombinant Protein (H00001359-Q01).

Blogs on CPA3

There are no specific blogs for CPA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPA3 Antibody
NBP1-86117
IL-3 [Unconjugated]
203-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPA3