COX6B1 Antibody (2D3) - Azide and BSA Free

Western Blot: COX6B1 Antibody (2D3) [H00001340-M02] - Analysis of COX6B1 expression in transfected 293T cell line by COX6B1 monoclonal antibody (M02), clone 2D3.Lane 1: COX6B1 transfected lysate(10.2 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: COX6B1 Antibody (2D3) [H00001340-M02] - Detection limit for recombinant GST tagged COX6B1 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX6B1 Antibody (2D3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: COX6B1 (AAH01015, 1 a.a. ~ 86 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Specificity: COX6B1 - cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) (2D3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: COX6B1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX6B1 Antibody (2D3) - Azide and BSA Free

• COX VIb-1
• COX6B
• COXG
• COXVIb1
• cytochrome c oxidase subunit 6B1
• Cytochrome c oxidase subunit VIb isoform 1
• cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
• cytochrome c oxidase subunit Vib

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX6B1
• Entrez:
  • 1340(Human)
• Uniprot:
  • AAH01015(Human)