COX10 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

COX10 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX10.
  
  

  Source: E. coli

  Amino Acid Sequence: PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: COX10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86323.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COX10 Recombinant Protein Antigen

• COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase)
• COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast)
• cytochrome c oxidase assembly protein
• cytochrome c oxidase subunit X
• EC 2.5.1.-
• heme A: farnesyltransferase
• Heme O synthase
• protoheme IX farnesyltransferase, mitochondrial

Background

Cytochrome c oxidase assembly homolog 10 (COX10), also known as protoheme IX farnesyltransferase, mitochondrial, is a member of the UbiA prenyltransferase family. This protein converts protoheme 9 (IX) and farnexyl diphosphate to heme O. COX10 is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. Mutations to the COX10 gene have been linked to cytochrome c oxidase deficiency also known as mitochondrial complex IV deficiency (MT-D4D), Charcot-Marie-Tooth type 1A (CMT1A) duplication, and hereditary neuropathy with liability to pressure palsies (HNPP) deletion. Leigh syndrome has also been associated with defects in the COX10 gene where bilateral symmetrical necrotic lesions appear in the subcortical brain regions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: COX10