We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

COX10 Recombinant Protein Antigen

Images

 
There are currently no images for COX10 Protein (NBP1-86323PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COX10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX10.

Source: E. coli

Amino Acid Sequence: PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COX10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86323.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COX10 Recombinant Protein Antigen

  • COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase)
  • COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast)
  • cytochrome c oxidase assembly protein
  • cytochrome c oxidase subunit X
  • EC 2.5.1.-
  • heme A: farnesyltransferase
  • Heme O synthase
  • protoheme IX farnesyltransferase, mitochondrial

Background

Cytochrome c oxidase assembly homolog 10 (COX10), also known as protoheme IX farnesyltransferase, mitochondrial, is a member of the UbiA prenyltransferase family. This protein converts protoheme 9 (IX) and farnexyl diphosphate to heme O. COX10 is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. Mutations to the COX10 gene have been linked to cytochrome c oxidase deficiency also known as mitochondrial complex IV deficiency (MT-D4D), Charcot-Marie-Tooth type 1A (CMT1A) duplication, and hereditary neuropathy with liability to pressure palsies (HNPP) deletion. Leigh syndrome has also been associated with defects in the COX10 gene where bilateral symmetrical necrotic lesions appear in the subcortical brain regions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP3-35454
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-45778
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-77274
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87073
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-47544
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-85500
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-33413
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-44912
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-99469
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-92916
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83237
Species: Hu
Applications: IHC,  IHC-P
NBP3-27181
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP3-38464
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-92275
Species: Hu
Applications: IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for COX10 Protein (NBP1-86323PEP) (0)

There are no publications for COX10 Protein (NBP1-86323PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX10 Protein (NBP1-86323PEP) (0)

There are no reviews for COX10 Protein (NBP1-86323PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COX10 Protein (NBP1-86323PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX10 Products

Blogs on COX10

There are no specific blogs for COX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COX10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COX10