COQ5 Antibody

Images

 
Western Blot: COQ5 Antibody [NBP2-82738] - WB Suggested Anti-Coq5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Lung

Product Details

Summary
Reactivity Rt, Hu, Mu, Po, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COQ5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ5. Peptide sequence: RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Porcine (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
COQ5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COQ5 Antibody

  • coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
  • coenzyme Q5 homolog, methyltransferase (yeast)
  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.52
  • MGC104303
  • MGC4767
  • ubiquinone biosynthesis methyltransferase COQ5, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91806
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88724
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92917
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41176
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-81797
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88673
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, KO, PCR
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, Gp, Ha, Pm, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP1-86799
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for COQ5 Antibody (NBP2-82738) (0)

There are no publications for COQ5 Antibody (NBP2-82738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ5 Antibody (NBP2-82738) (0)

There are no reviews for COQ5 Antibody (NBP2-82738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COQ5 Antibody (NBP2-82738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COQ5 Products

Bioinformatics Tool for COQ5 Antibody (NBP2-82738)

Discover related pathways, diseases and genes to COQ5 Antibody (NBP2-82738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ5 Antibody (NBP2-82738)

Discover more about diseases related to COQ5 Antibody (NBP2-82738).
 

Pathways for COQ5 Antibody (NBP2-82738)

View related products by pathway.

PTMs for COQ5 Antibody (NBP2-82738)

Learn more about PTMs related to COQ5 Antibody (NBP2-82738).

Blogs on COQ5

There are no specific blogs for COQ5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ5