![Western Blot: COQ5 Antibody [NBP2-82738] - WB Suggested Anti-Coq5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Lung](http://images.novusbio.com/fullsize/COQ5-Antibody-Western-Blot-NBP2-82738-img0001.jpg "Western Blot: COQ5 Antibody [NBP2-82738] - WB Suggested Anti-Coq5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Lung")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit COQ5 Antibody - BSA Free (NBP2-82738) is a polyclonal antibody validated for use in WB. Anti-COQ5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ5. Peptide sequence: RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COQ5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Luis Carlos López García |
WB | Mouse | 04/08/2024 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COQ5 |
![Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] - Analysis of Rabbit Polyclonal COQ5 Antibody using mouse liver tissue. A band at the expected molecular weight (about 37kDa) is observed. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500. Image from a verified customer review.](http://images.novusbio.com/fullsize/nbp2-82738_rabbit-polyclonal-coq5-antibody-western-blot-105202415731..png "Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-82738] - Analysis of Rabbit Polyclonal COQ5 Antibody using mouse liver tissue. A band at the expected molecular weight (about 37kDa) is observed. Technical data: Blocking in milk. Primary antibody dilution: 1:500. Secondary antibody dilution: 1:2500. Image from a verified customer review.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
