Connexin 36/GJD2 Antibody

Product Discontinued

Connexin 36/GJD2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAYV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Connexin 36/GJD2 Antibody

• Connexin 36
• Connexin-36
• CX36
• CX36connexin 36
• Gap junction alpha-9 protein
• gap junction delta-2 protein
• gap junction protein, alpha 9, 36kDa
• gap junction protein, delta 2, 36kDa
• GJA9connexin-36
• GJD2
• MGC138315
• MGC138319

Background

The Connexin 36 / GJA9 gene is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is forme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJD2