Complement Factor MASP3/MASP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Complement Factor MASP3/MASP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MASP1.
  
  

  Source: E. coli

  Amino Acid Sequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MASP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85460.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement Factor MASP3/MASP1 Recombinant Protein Antigen

• Complement Factor MASP3
• Complement factor MASP-3
• Complement-activating component of Ra-reactive factor
• CRARF1
• CRARFMAP1
• DKFZp686I01199
• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.104
• EC 3.4.21.42
• FLJ26383
• mannan-binding lectin serine peptidase 1 (C4/C2 activating component ofRa-reactive factor)
• mannan-binding lectin serine protease 1 (C4/C2 activating component ofRa-reactive factor)
• mannan-binding lectin serine protease 1
• Mannose-binding lectin-associated serine protease 1
• Mannose-binding protein-associated serine protease
• MAp44
• MASP
• MASP1
• MASP-1
• MASP3
• MGC126283
• MGC126284
• PRSS5
• Ra-reactive factor serine protease p100
• RaRF
• Serine protease 5

Background

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in multiple transcript variants encoding two RARF components that are involved in the mannan-binding lectin (MBL) pathway of complement activation. Two of the isoforms are cleaved into two chains which form a heterodimer linked by a disulfide bond. The encoded proteins are members of the trypsin family of peptidases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MASP1