![Western Blot: COMMD9 Antibody [NBP1-82027] - Analysis in control (vector only transfected HEK293T lysate) and COMMD9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/COMMD9-Antibody-Western-Blot-NBP1-82027-img0008.jpg "Western Blot: COMMD9 Antibody [NBP1-82027] - Analysis in control (vector only transfected HEK293T lysate) and COMMD9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTV |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COMMD9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COMMD9 |
![Immunocytochemistry/Immunofluorescence: COMMD9 Antibody [NBP1-82027] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/COMMD9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82027-img0007.jpg "Immunocytochemistry/Immunofluorescence: COMMD9 Antibody [NBP1-82027] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: COMMD9 Antibody [NBP1-82027] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COMMD9-Antibody-Immunohistochemistry-Paraffin-NBP1-82027-img0006.jpg "Immunohistochemistry-Paraffin: COMMD9 Antibody [NBP1-82027] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry Laminin alpha 4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Laminin_alpha_4_AF3837_Immunohistochemistry_17439.jpg)
![Immunohistochemistry Laminin alpha 4 Antibody [Unconjugated]](https://images.novusbio.com/images/af3837_mouse-laminin-alpha-4-affinity-purified-polyclonal-ab-8120255552810.jpg)
![Immunohistochemistry Laminin alpha 4 Antibody [Unconjugated]](https://images.novusbio.com/images/af3837_mouse-laminin-alpha-4-affinity-purified-polyclonal-ab-8120255531652.jpg)