Recombinant Human COG6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COG6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 558-657 of Human COG6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS

Protein/Peptide Type
Partial Recombinant Protein
Gene
COG6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COG6 Protein

  • COG complex subunit 6
  • component of oligomeric golgi complex 6KIAA1134COD2complexed with Dor1p 2
  • conserved oligomeric Golgi complex protein 6
  • conserved oligomeric Golgi complex subunit 6
  • DKFZp313D191

Background

COG6 - component of oligomeric golgi complex 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP2-47502
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-31735
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00057511-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for COG6 Partial Recombinant Protein (H00057511-Q01) (0)

There are no publications for COG6 Partial Recombinant Protein (H00057511-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG6 Partial Recombinant Protein (H00057511-Q01) (0)

There are no reviews for COG6 Partial Recombinant Protein (H00057511-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COG6 Partial Recombinant Protein (H00057511-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG6 Products

Bioinformatics Tool for COG6 Partial Recombinant Protein (H00057511-Q01)

Discover related pathways, diseases and genes to COG6 Partial Recombinant Protein (H00057511-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG6 Partial Recombinant Protein (H00057511-Q01)

Discover more about diseases related to COG6 Partial Recombinant Protein (H00057511-Q01).
 

Pathways for COG6 Partial Recombinant Protein (H00057511-Q01)

View related products by pathway.

PTMs for COG6 Partial Recombinant Protein (H00057511-Q01)

Learn more about PTMs related to COG6 Partial Recombinant Protein (H00057511-Q01).
 

Research Areas for COG6 Partial Recombinant Protein (H00057511-Q01)

Find related products by research area.

Blogs on COG6

There are no specific blogs for COG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COG6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COG6