Recombinant Human COG2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COG2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 639-738 of Human COG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
COG2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COG2 Protein

  • component of oligomeric golgi complex 2COG complex subunit 2
  • conserved oligomeric Golgi complex protein 2
  • conserved oligomeric Golgi complex subunit 2
  • LDLCbrefeldin A-sensitive, peripheral Golgi protein
  • low density lipoprotein receptor defect C complementing
  • Low density lipoprotein receptor defect C-complementing protein

Background

COG2 - component of oligomeric golgi complex 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00022796-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for COG2 Partial Recombinant Protein (H00022796-Q01) (0)

There are no publications for COG2 Partial Recombinant Protein (H00022796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG2 Partial Recombinant Protein (H00022796-Q01) (0)

There are no reviews for COG2 Partial Recombinant Protein (H00022796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COG2 Partial Recombinant Protein (H00022796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG2 Products

Bioinformatics Tool for COG2 Partial Recombinant Protein (H00022796-Q01)

Discover related pathways, diseases and genes to COG2 Partial Recombinant Protein (H00022796-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG2 Partial Recombinant Protein (H00022796-Q01)

Discover more about diseases related to COG2 Partial Recombinant Protein (H00022796-Q01).
 

Pathways for COG2 Partial Recombinant Protein (H00022796-Q01)

View related products by pathway.

PTMs for COG2 Partial Recombinant Protein (H00022796-Q01)

Learn more about PTMs related to COG2 Partial Recombinant Protein (H00022796-Q01).
 

Research Areas for COG2 Partial Recombinant Protein (H00022796-Q01)

Find related products by research area.

Blogs on COG2

There are no specific blogs for COG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COG2 Antibody
NBP2-57681
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COG2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COG2