Coagulation Factor XI Antibody (3C7)

Images

 
There are currently no images for Coagulation Factor XI Antibody (H00002160-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Coagulation Factor XI Antibody (3C7) Summary

Immunogen
F11 (NP_000119 286 a.a. - 385 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coagulation Factor XI Antibody (3C7)

  • Coagulation Factor XI
  • EC 3.4.21
  • EC 3.4.21.27
  • FXIPlasma thromboplastin antecedent
  • MGC141891
  • PTA

Background

Factor XI is a secreted homodimer, disulfide-linked. Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX, by selective cleavage of Arg-|-Ala and Arg-|-Val bonds in factor IX to form factor IXa. It is produced by platelets and megakaryocytes but is absent from other blood cells. It is activated by factor XIIa (or XII), which cleaves each polypeptide after Arg-387 into the light chain, which contains the active site, and the heavy chain, which associates with high molecular weight (HMW) kininogen. After activation the heavy and light chains are also linked by a disulfide bond. Factor XI belongs to the peptidase S1 family, plasma kallikrein subfamily and it contains 4 apple domains. Defects in F11 are the cause of F11 deficiency; also called plasma thromboplastin antecedent deficiency or Rosenthal syndrome. It is a blood coagulation abnormality occurring in high frequency in Ashkenazi Jews. F11-deficient patients are prone to excessive bleeding after haemostatic challenge.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for Coagulation Factor XI Antibody (H00002160-M02) (0)

There are no publications for Coagulation Factor XI Antibody (H00002160-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor XI Antibody (H00002160-M02) (0)

There are no reviews for Coagulation Factor XI Antibody (H00002160-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Coagulation Factor XI Antibody (H00002160-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Coagulation Factor XI Products

Bioinformatics Tool for Coagulation Factor XI Antibody (H00002160-M02)

Discover related pathways, diseases and genes to Coagulation Factor XI Antibody (H00002160-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor XI Antibody (H00002160-M02)

Discover more about diseases related to Coagulation Factor XI Antibody (H00002160-M02).
 

Pathways for Coagulation Factor XI Antibody (H00002160-M02)

View related products by pathway.

PTMs for Coagulation Factor XI Antibody (H00002160-M02)

Learn more about PTMs related to Coagulation Factor XI Antibody (H00002160-M02).
 

Research Areas for Coagulation Factor XI Antibody (H00002160-M02)

Find related products by research area.

Blogs on Coagulation Factor XI

There are no specific blogs for Coagulation Factor XI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coagulation Factor XI Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol F11
Entrez
Uniprot