CNOT2 Antibody (2E10.)

Images

 
ELISA: CNOT2 Antibody (2E10) [H00004848-M03] - Detection limit for recombinant GST tagged CNOT2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNOT2 Antibody (2E10.) Summary

Immunogen
CNOT2 (NP_055330 441 a.a. - 540 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Specificity
CNOT2 - CCR4-NOT transcription complex, subunit 2 (2E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CNOT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNOT2 Antibody (2E10.)

  • CCR4-associated factor 2
  • CCR4-NOT transcription complex, subunit 2
  • CDC36FLJ26456
  • negative regulator of transcription 2
  • NOT2CCR4-NOT transcription complex subunit 2
  • NOT2H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-24527
Species: Hu, Mu, Rt, Bv, Ch, Xp
Applications: WB, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011140-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-496
Species: Hu
Applications: WB, IHC-P, IP

Publications for CNOT2 Antibody (H00004848-M03) (0)

There are no publications for CNOT2 Antibody (H00004848-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT2 Antibody (H00004848-M03) (0)

There are no reviews for CNOT2 Antibody (H00004848-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNOT2 Antibody (H00004848-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT2 Products

Bioinformatics Tool for CNOT2 Antibody (H00004848-M03)

Discover related pathways, diseases and genes to CNOT2 Antibody (H00004848-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT2 Antibody (H00004848-M03)

Discover more about diseases related to CNOT2 Antibody (H00004848-M03).
 

Pathways for CNOT2 Antibody (H00004848-M03)

View related products by pathway.

PTMs for CNOT2 Antibody (H00004848-M03)

Learn more about PTMs related to CNOT2 Antibody (H00004848-M03).

Blogs on CNOT2

There are no specific blogs for CNOT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT2 Antibody (2E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT2
Entrez
Uniprot