CNKSR1 Antibody


Western Blot: CNKSR1 Antibody [NBP2-84703] - WB Suggested Anti-CNKSR1 Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CNKSR1 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of CNKSR1. Peptide sequence: SPAATPTQRSPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQE The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for CNKSR1 Antibody

  • CNK
  • CNK1
  • CNK1CNK homolog protein 1
  • connector enhancer of kinase suppressor of Ras 1
  • Connector enhancer of KSR 1
  • Connector enhancer of KSR-like
  • hCNK1
  • KSR


The CNKSR1 gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target.It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.(provided by RefSeq)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
Species: Hu
Applications: WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB

Publications for CNKSR1 Antibody (NBP2-84703) (0)

There are no publications for CNKSR1 Antibody (NBP2-84703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNKSR1 Antibody (NBP2-84703) (0)

There are no reviews for CNKSR1 Antibody (NBP2-84703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNKSR1 Antibody (NBP2-84703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNKSR1 Products

Bioinformatics Tool for CNKSR1 Antibody (NBP2-84703)

Discover related pathways, diseases and genes to CNKSR1 Antibody (NBP2-84703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNKSR1 Antibody (NBP2-84703)

Discover more about diseases related to CNKSR1 Antibody (NBP2-84703).

Pathways for CNKSR1 Antibody (NBP2-84703)

View related products by pathway.

PTMs for CNKSR1 Antibody (NBP2-84703)

Learn more about PTMs related to CNKSR1 Antibody (NBP2-84703).

Blogs on CNKSR1

There are no specific blogs for CNKSR1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNKSR1 Antibody and receive a gift card or discount.


Gene Symbol CNKSR1