CNGA4 Antibody - BSA Free

Staining of human cell line HaCaT shows localization to nucleoplasm & plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CNGA4 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CNGA4 using the following amino acid sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNGA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CNGA4 Antibody - BSA Free

• CNCA2
• CNG channel alpha-4
• CNG4
• CNG-4
• CNG5
• CNGB2
• cyclic nucleotide gated channel alpha 4
• cyclic nucleotide gated channel beta 2
• cyclic nucleotide-gated cation channel alpha-4
• Cyclic nucleotide-gated channel alpha-4
• MGC126168
• MGC126169
• OCNC2
• OCNCb
• OCNCBETA

Background

CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNGA4