Clusterin-like 1/CLUL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Clusterin-like 1/CLUL1 Antibody [NBP2-69003] - Staining of human cell line U-2 OS shows localization to plasma membrane & endoplasmic reticulum.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Clusterin-like 1/CLUL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLUL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Clusterin-like 1/CLUL1 Recombinant Protein Antigen (NBP2-69003PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Clusterin-like 1/CLUL1 Antibody - BSA Free

• CLUL1
• Clusterin like 1
• clusterin-like 1 (retinal)
• Clusterin-like 1
• clusterin-like protein 1
• RA337M
• Retinal-specific clusterin-like protein

Background

CLUL1 (Clusterin-like protein 1) is a 466 amino acid protein. It is a member of the clusterin family of proteins. It is retinal specific and may play a role in Myopia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLUL1