CLK4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CLK4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLK4.
  
  

  Source: E. coli

  Amino Acid Sequence: EYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CLK4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47505.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLK4 Recombinant Protein Antigen

• CDC-like kinase 4
• CDC-like kinase 4EC 2.7.12.1
• CLK4
• DKFZp686A20267
• dual specificity protein kinase CLK4
• protein serine threonine kinase Clk4

Background

The protein encoded by the CLK4 gene belongs to the CDC2-like protein kinase (CLK) family. This protein kinase can interactwith and phosphorylate the serine- and arginine-rich (SR) proteins, which are known to play an important role in theformation of spliceosomes, and thus may be involved in the regulation of alternative splicing. Studies in the Israelisand rat Psammomys obesus suggested that the ubiquitin-like 5 (UBL5/BEACON), a highly conserved ubiquitin-likeprotein, may interact with and regulate the activity of this kinase. Multiple alternatively spliced transcriptvariants have been observed, but the full-length natures of which have not yet been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CLK4