Recombinant Human CLIC3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CLIC3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-236 of Human CLIC3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Protein/Peptide Type
Recombinant Protein
Gene
CLIC3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLIC3 Protein

  • chloride intracellular channel 3
  • chloride intracellular channel protein 3

Background

CLIC3( AAH07012, 1 a.a. - 237 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48694
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32516
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31793
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009022-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CLIC3 Recombinant Protein (H00009022-P01) (0)

There are no publications for CLIC3 Recombinant Protein (H00009022-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC3 Recombinant Protein (H00009022-P01) (0)

There are no reviews for CLIC3 Recombinant Protein (H00009022-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIC3 Recombinant Protein (H00009022-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLIC3 Products

Bioinformatics Tool for CLIC3 Recombinant Protein (H00009022-P01)

Discover related pathways, diseases and genes to CLIC3 Recombinant Protein (H00009022-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC3 Recombinant Protein (H00009022-P01)

Discover more about diseases related to CLIC3 Recombinant Protein (H00009022-P01).
 

Pathways for CLIC3 Recombinant Protein (H00009022-P01)

View related products by pathway.

PTMs for CLIC3 Recombinant Protein (H00009022-P01)

Learn more about PTMs related to CLIC3 Recombinant Protein (H00009022-P01).

Blogs on CLIC3

There are no specific blogs for CLIC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CLIC3 Antibody
NBP1-89465

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLIC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC3