CLCA1 Antibody (1C4)

Images

 
Sandwich ELISA: CLCA1 Antibody (1C4) [H00001179-M02] - Detection limit for recombinant GST tagged CLCA1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLCA1 Antibody (1C4) Summary

Immunogen
CLCA1 (NP_001276, 677 a.a. ~ 776 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
Specificity
CLCA1 - chloride channel, calcium activated, family member 1 (1C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLCA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001179-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLCA1 Antibody (1C4)

  • CaCC
  • CaCC-1
  • Calcium-activated chloride channel family member 1
  • Calcium-activated chloride channel protein 1
  • chloride channel accessory 1
  • chloride channel regulator 1
  • chloride channel regulator
  • chloride channel, calcium activated, family member 1
  • CLCA1
  • CLCRG1
  • FLJ95147
  • GOB5
  • hCaCC-1
  • HCLCA1

Background

This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-32841
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
M1300CB
Species: Mu
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
H00009629-P01
Species: Hu
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
409-ML/CF
Species: Mu
NBP2-61701
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-33482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
H00001179-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for CLCA1 Antibody (H00001179-M02)(1)

Reviews for CLCA1 Antibody (H00001179-M02) (0)

There are no reviews for CLCA1 Antibody (H00001179-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCA1 Antibody (H00001179-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLCA1 Products

Array H00001179-M02

Bioinformatics Tool for CLCA1 Antibody (H00001179-M02)

Discover related pathways, diseases and genes to CLCA1 Antibody (H00001179-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCA1 Antibody (H00001179-M02)

Discover more about diseases related to CLCA1 Antibody (H00001179-M02).
 

Pathways for CLCA1 Antibody (H00001179-M02)

View related products by pathway.

PTMs for CLCA1 Antibody (H00001179-M02)

Learn more about PTMs related to CLCA1 Antibody (H00001179-M02).

Blogs on CLCA1

There are no specific blogs for CLCA1, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCA1 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCA1
Entrez
Uniprot