Recombinant Human Claudin 10 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Claudin 10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-228 of Human CLDN10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CLDN10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Theoretical MW
50.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin 10 Protein

  • claudin 10
  • claudin-10
  • CPETRL3
  • OSP-L
  • OSP-like protein

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Two alternatively spliced transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-58264
Species: Hu
Applications: ICC/IF
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-85047
Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-02259
Species: Hu, Po
Applications: Flow, ICC/IF, ICC
NBP2-38777
Species: Hu
Applications: IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP2-32002
Species: Hu
Applications: IHC, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-39043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
H00149461-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00009071-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Claudin 10 Recombinant Protein (H00009071-P01) (0)

There are no publications for Claudin 10 Recombinant Protein (H00009071-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin 10 Recombinant Protein (H00009071-P01) (0)

There are no reviews for Claudin 10 Recombinant Protein (H00009071-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin 10 Recombinant Protein (H00009071-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Claudin 10 Recombinant Protein (H00009071-P01)

Discover related pathways, diseases and genes to Claudin 10 Recombinant Protein (H00009071-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin 10 Recombinant Protein (H00009071-P01)

Discover more about diseases related to Claudin 10 Recombinant Protein (H00009071-P01).
 

Pathways for Claudin 10 Recombinant Protein (H00009071-P01)

View related products by pathway.

Blogs on Claudin 10

There are no specific blogs for Claudin 10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin 10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN10