Recombinant Human CL-K1/COLEC11 Protein

Product Discontinued

Recombinant Human CL-K1/COLEC11 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-271 of Human COLEC11 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: COLEC11
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 55.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CL-K1/COLEC11 Protein

• CLK1
• CL-K1
• CL-K1-I
• CL-K1-II
• CL-K1-IIa
• CL-K1-IIb
• COLEC11
• collectin kidney I
• Collectin kidney protein 1
• collectin sub-family member 11
• collectin-11
• DKFZp686N1868
• MGC3279

Background

COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydraterecognition domain, and play a role in host-defense (Keshi et al., 2006 (PubMed 17179669)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CL-K1/COLEC11 Recombinant Protein (H00078989-P01)(1)

Publication using H00078989-P01

• Munye MM, Diaz-Font A, Ocaka L et al. COLEC10 is mutated in 3MC patients and regulates early craniofacial development PLoS Genet 2017-03-01 [PMID: 28301481]

Bioinformatics

• Gene Symbol: COLEC11