CKMT2 Antibody

Images

 
Western Blot: CKMT2 Antibody [H00001160-D01P] - Analysis of CKMT2 expression in transfected 293T cell line by CKMT2 polyclonal antibody.Lane 1: CKMT2 transfected lysate(47.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CKMT2 Antibody Summary

Immunogen
CKMT2 (AAH29140.1, 1 a.a. - 419 a.a.) full-length human protein. MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKMT2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKMT2 Antibody

  • Basic-type mitochondrial creatine kinase
  • creatine kinase S-type, mitochondrial
  • creatine kinase, mitochondrial 2 (sarcomeric)
  • EC 2.7.3
  • EC 2.7.3.2
  • mib-CK
  • Sarcomeric mitochondrial creatine kinase
  • SMTCK
  • S-MtCK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13840
Species: Hu
Applications: WB, IHC, IHC-P
MAB5564
Species: Hu
Applications: WB, Simple Western
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for CKMT2 Antibody (H00001160-D01P) (0)

There are no publications for CKMT2 Antibody (H00001160-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKMT2 Antibody (H00001160-D01P) (0)

There are no reviews for CKMT2 Antibody (H00001160-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKMT2 Antibody (H00001160-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CKMT2 Products

Bioinformatics Tool for CKMT2 Antibody (H00001160-D01P)

Discover related pathways, diseases and genes to CKMT2 Antibody (H00001160-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKMT2 Antibody (H00001160-D01P)

Discover more about diseases related to CKMT2 Antibody (H00001160-D01P).
 

Pathways for CKMT2 Antibody (H00001160-D01P)

View related products by pathway.

PTMs for CKMT2 Antibody (H00001160-D01P)

Learn more about PTMs related to CKMT2 Antibody (H00001160-D01P).

Blogs on CKMT2

There are no specific blogs for CKMT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CKMT2
Uniprot