CIRBP Antibody [mFluor Violet 610 SE]

Product Discontinued

CIRBP Antibody [mFluor Violet 610 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (NP_001271.1).
  
  Sequence:
  MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIRBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for CIRBP Antibody [mFluor Violet 610 SE]

• A18 hnRNP
• A18HNRNP
• CIRPcold-inducible RNA-binding protein
• cold inducible RNA binding protein
• cold inducible RNA-binding protein
• glycine-rich RNA binding protein
• Glycine-rich RNA-binding protein CIRP

Background

Seems to play an essential role in cold-induced suppression of cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIRBP