CIRBP Antibody (1C9) - Azide and BSA Free

Western Blot: CIRBP Antibody (1C9) [H00001153-M03] - Analysis of CIRBP expression in transfected 293T cell line by CIRBP monoclonal antibody (M03), clone 1C9. Lane 1: CIRBP transfected lysate (Predicted MW: 18.6 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: CIRBP Antibody (1C9) [H00001153-M03] - Analysis of monoclonal antibody to CIRBP on HeLa cell. Antibody concentration 10 ug/ml

ELISA: CIRBP Antibody (1C9) [H00001153-M03] - Detection limit for recombinant GST tagged CIRBP is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1C9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CIRBP Antibody (1C9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CIRBP (NP_001271.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRS
• Specificity: CIRBP - cold inducible RNA binding protein (1C9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CIRBP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIRBP Antibody (1C9) - Azide and BSA Free

• A18 hnRNP
• A18HNRNP
• CIRPcold-inducible RNA-binding protein
• cold inducible RNA binding protein
• cold inducible RNA-binding protein
• glycine-rich RNA binding protein
• Glycine-rich RNA-binding protein CIRP

Background

Seems to play an essential role in cold-induced suppression of cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIRBP
• Entrez:
  • 1153(Human)
• Uniprot:
  • NP_001271(Human)