CHST8 Antibody - BSA Free

Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - This Anti-CHST8 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Discontinued

CHST8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CHST8(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8) The peptide sequence was selected from the middle region of CHST8. Peptide sequence GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHST8 Antibody - BSA Free

• carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
• carbohydrate sulfotransferase 8
• EC 2.8.2.-
• GalNAc-4-O-sulfotransferase 1
• GalNAc4ST
• GALNAC4ST1
• GALNAC-4-ST1
• galNAc4ST-1
• N-acetylgalactosamine-4-O-sulfotransferase 1

Background

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHST8
• Uniprot:
  • Q9H2A9(Human)