CHST8 Antibody


Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: CHST8 Antibody [NBP1-69273] - This Anti-CHST8 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.
Western Blot: CHST8 Antibody [NBP1-69273] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CHST8 Antibody Summary

Synthetic peptides corresponding to CHST8(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8) The peptide sequence was selected from the middle region of CHST8. Peptide sequence GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHST8 and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHST8 Antibody

  • carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
  • carbohydrate sulfotransferase 8
  • EC 2.8.2.-
  • GalNAc-4-O-sulfotransferase 1
  • GalNAc4ST
  • GALNAC-4-ST1
  • galNAc4ST-1
  • N-acetylgalactosamine-4-O-sulfotransferase 1


Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC, Neut
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHST8 Antibody (NBP1-69273) (0)

There are no publications for CHST8 Antibody (NBP1-69273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST8 Antibody (NBP1-69273) (0)

There are no reviews for CHST8 Antibody (NBP1-69273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST8 Antibody (NBP1-69273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHST8 Products

Bioinformatics Tool for CHST8 Antibody (NBP1-69273)

Discover related pathways, diseases and genes to CHST8 Antibody (NBP1-69273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST8 Antibody (NBP1-69273)

Discover more about diseases related to CHST8 Antibody (NBP1-69273).

Pathways for CHST8 Antibody (NBP1-69273)

View related products by pathway.

PTMs for CHST8 Antibody (NBP1-69273)

Learn more about PTMs related to CHST8 Antibody (NBP1-69273).

Blogs on CHST8

There are no specific blogs for CHST8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHST8 Antibody and receive a gift card or discount.


Gene Symbol CHST8