Recombinant Human CHST11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHST11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 230-337 of Human CHST11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD

Protein/Peptide Type
Partial Recombinant Protein
Gene
CHST11

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHST11 Protein

  • C4S-1
  • C4ST
  • C4ST-1
  • C4ST1EC 2.8.2.5
  • carbohydrate (chondroitin 4) sulfotransferase 11
  • carbohydrate sulfotransferase 11
  • Chondroitin 4-O-sulfotransferase 1
  • Chondroitin 4-sulfotransferase 1
  • DKFZp667A035
  • FLJ41682
  • HSA269537
  • IgH/CHST11 fusion

Background

CHST11 - carbohydrate (chondroitin 4) sulfotransferase 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MAB7450
Species: Hu
Applications: IHC
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
NBP1-88367
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-59944
Species: Hu
Applications: WB
NBP2-57389
Species: Hu
Applications: WB, IHC-P
NBP2-15898
Species: Hu, Mu
Applications: WB

Publications for CHST11 Partial Recombinant Protein (H00050515-Q01) (0)

There are no publications for CHST11 Partial Recombinant Protein (H00050515-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST11 Partial Recombinant Protein (H00050515-Q01) (0)

There are no reviews for CHST11 Partial Recombinant Protein (H00050515-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST11 Partial Recombinant Protein (H00050515-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHST11 Products

Bioinformatics Tool for CHST11 Partial Recombinant Protein (H00050515-Q01)

Discover related pathways, diseases and genes to CHST11 Partial Recombinant Protein (H00050515-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST11 Partial Recombinant Protein (H00050515-Q01)

Discover more about diseases related to CHST11 Partial Recombinant Protein (H00050515-Q01).
 

Pathways for CHST11 Partial Recombinant Protein (H00050515-Q01)

View related products by pathway.

PTMs for CHST11 Partial Recombinant Protein (H00050515-Q01)

Learn more about PTMs related to CHST11 Partial Recombinant Protein (H00050515-Q01).

Blogs on CHST11

There are no specific blogs for CHST11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHST11 Antibody
NBP2-30481

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHST11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST11