Recombinant Human Chromogranin C GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 508-617 of Human Chromogranin C Source: Wheat Germ (in vitro) Amino Acid Sequence: LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Recombinant Protein |
Gene |
SCG2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Chromogranin C GST (N-Term) Protein
Background
SCG2 - secretogranin II (chromogranin C)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Chromogranin C Partial Recombinant Protein (H00007857-Q01) (0)
There are no publications for Chromogranin C Partial Recombinant Protein (H00007857-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chromogranin C Partial Recombinant Protein (H00007857-Q01) (0)
There are no reviews for Chromogranin C Partial Recombinant Protein (H00007857-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Chromogranin C Partial Recombinant Protein (H00007857-Q01). (Showing 1 - 1 of 1 FAQ).
-
I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628
- The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.
Additional Chromogranin C Products
Research Areas for Chromogranin C Partial Recombinant Protein (H00007857-Q01)
Find related products by research area.
|
Blogs on Chromogranin C