Recombinant Human Chromogranin C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Chromogranin C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 508-617 of Human SCG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCG2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Chromogranin C Protein

  • CHCG
  • Chromogranin-C
  • EM66
  • SCG2
  • secretogranin IICHGCchromogranin-C
  • secretoneurin
  • SgIIsecretogranin-2
  • SN

Background

SCG2 - secretogranin II (chromogranin C)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
H00007857-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Chromogranin C Partial Recombinant Protein (H00007857-Q01) (0)

There are no publications for Chromogranin C Partial Recombinant Protein (H00007857-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chromogranin C Partial Recombinant Protein (H00007857-Q01) (0)

There are no reviews for Chromogranin C Partial Recombinant Protein (H00007857-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chromogranin C Partial Recombinant Protein (H00007857-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628
    • The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

Additional Chromogranin C Products

Bioinformatics Tool for Chromogranin C Partial Recombinant Protein (H00007857-Q01)

Discover related pathways, diseases and genes to Chromogranin C Partial Recombinant Protein (H00007857-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chromogranin C Partial Recombinant Protein (H00007857-Q01)

Discover more about diseases related to Chromogranin C Partial Recombinant Protein (H00007857-Q01).
 

Pathways for Chromogranin C Partial Recombinant Protein (H00007857-Q01)

View related products by pathway.

Blogs on Chromogranin C

There are no specific blogs for Chromogranin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Chromogranin C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCG2