Chromogranin C Antibody (6B7)

Images

 
There are currently no images for Chromogranin C Antibody (H00007857-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
6B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Chromogranin C Antibody (6B7) Summary

Immunogen
SCG2 (NP_003460 508 a.a. - 617 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM
Specificity
SCG2 - secretogranin II (chromogranin C)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chromogranin C Antibody (6B7)

  • CHCG
  • Chromogranin-C
  • EM66
  • SCG2
  • secretogranin IICHGCchromogranin-C
  • secretoneurin
  • SgIIsecretogranin-2
  • SN

Background

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
H00007857-M01
Species: Hu
Applications: ELISA

Publications for Chromogranin C Antibody (H00007857-M01) (0)

There are no publications for Chromogranin C Antibody (H00007857-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chromogranin C Antibody (H00007857-M01) (0)

There are no reviews for Chromogranin C Antibody (H00007857-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chromogranin C Antibody (H00007857-M01). (Showing 1 - 1 of 1 FAQ).

  1. I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628
    • The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

Secondary Antibodies

 

Isotype Controls

Additional Chromogranin C Products

Bioinformatics Tool for Chromogranin C Antibody (H00007857-M01)

Discover related pathways, diseases and genes to Chromogranin C Antibody (H00007857-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chromogranin C Antibody (H00007857-M01)

Discover more about diseases related to Chromogranin C Antibody (H00007857-M01).
 

Pathways for Chromogranin C Antibody (H00007857-M01)

View related products by pathway.

Blogs on Chromogranin C

There are no specific blogs for Chromogranin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chromogranin C Antibody (6B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCG2
Entrez
OMIM
Uniprot