Chondrolectin Antibody (1A5)

Sandwich ELISA: Chondrolectin Antibody (1A5) [H00140578-M03] - Detection limit for recombinant GST tagged CHODL is 0.3 ng/ml as a capture antibody.

Product Discontinued

Chondrolectin Antibody (1A5) Summary

• Immunogen: CHODL (NP_079220, 23 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGI
• Specificity: CHODL - chondrolectin (1A5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CHODL
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chondrolectin Antibody (1A5)

• C21orf68
• CHODL
• Chondrolectin
• chromosome 21 open reading frame 68
• FLJ12627
• MT75
• PRED12
• Transmembrane protein MT75

Background

This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHODL
• Entrez:
  • 140578(Human)
• Uniprot:
  • NP_079220()