CHERP Antibody

Images

 
Western Blot: CHERP Antibody [NBP1-80456] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHERP Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human CHERP. Peptide sequence SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHERP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CHERP and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHERP Antibody

  • calcium homeostasis endoplasmic reticulum protein
  • DAN16
  • DAN26
  • ERPROT 213-21
  • ERPROT213-21
  • protein with polyglutamine repeat
  • SCAF6
  • SRA1
  • SR-related CTD associated factor 6
  • SR-related CTD-associated factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
AF5514
Species: Hu, Mu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-57502
Species: Hu
Applications: ICC/IF
NBP1-80456
Species: Hu
Applications: WB

Publications for CHERP Antibody (NBP1-80456) (0)

There are no publications for CHERP Antibody (NBP1-80456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHERP Antibody (NBP1-80456) (0)

There are no reviews for CHERP Antibody (NBP1-80456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHERP Antibody (NBP1-80456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHERP Products

Bioinformatics Tool for CHERP Antibody (NBP1-80456)

Discover related pathways, diseases and genes to CHERP Antibody (NBP1-80456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHERP Antibody (NBP1-80456)

Discover more about diseases related to CHERP Antibody (NBP1-80456).
 

Pathways for CHERP Antibody (NBP1-80456)

View related products by pathway.

PTMs for CHERP Antibody (NBP1-80456)

Learn more about PTMs related to CHERP Antibody (NBP1-80456).

Blogs on CHERP

There are no specific blogs for CHERP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHERP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHERP
Uniprot