Recombinant Human CGI 62 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CGI 62 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-325 of Human C8orf70 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL

Protein/Peptide Type
Recombinant Protein
Gene
ZC2HC1A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CGI 62 Protein

  • C8orf70
  • CGI-62
  • chromosome 8 open reading frame 70
  • family with sequence similarity 164, member A
  • hypothetical protein LOC51101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP2-20746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91550
Species: Hu
Applications: WB, IHC, IHC-P
594-ML/CF
Species: Mu
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P
NBP2-46374
Species: Hu
Applications: WB, IHC
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CGI 62 Recombinant Protein (H00051101-P01) (0)

There are no publications for CGI 62 Recombinant Protein (H00051101-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGI 62 Recombinant Protein (H00051101-P01) (0)

There are no reviews for CGI 62 Recombinant Protein (H00051101-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CGI 62 Recombinant Protein (H00051101-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CGI 62 Products

Bioinformatics Tool for CGI 62 Recombinant Protein (H00051101-P01)

Discover related pathways, diseases and genes to CGI 62 Recombinant Protein (H00051101-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CGI 62

There are no specific blogs for CGI 62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
CGI 62 Antibody
NBP1-88246
IL-7 [Unconjugated]
207-IL-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CGI 62 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC2HC1A