Ceramide Kinase Like Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 359-558 of human CERKL (NP_001025482.1). LAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMIPK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CERKL |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Ceramide Kinase Like Antibody - Azide and BSA Free
Background
Ceramide kinases convert the sphingolipid metabolite ceramide into ceramide-1-phosphate, both key mediators of cellularapoptosis and survival. Ceramide metabolism plays an essential role in the viability of neuronal cells, the membranesof which are particularly rich in sphingolipids (Tuson et al., 2004 (PubMed 14681825)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Ceramide Kinase Like Antibody (NBP2-92288) (0)
There are no publications for Ceramide Kinase Like Antibody (NBP2-92288).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ceramide Kinase Like Antibody (NBP2-92288) (0)
There are no reviews for Ceramide Kinase Like Antibody (NBP2-92288).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ceramide Kinase Like Antibody (NBP2-92288) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ceramide Kinase Like Products
Research Areas for Ceramide Kinase Like Antibody (NBP2-92288)
Find related products by research area.
|
Blogs on Ceramide Kinase Like