Centrin 3 Recombinant Protein Antigen

Images

 
There are currently no images for Centrin 3 Protein (NBP1-84547PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Centrin 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CETN3.

Source: E. coli

Amino Acid Sequence: AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CETN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84547.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Centrin 3 Recombinant Protein Antigen

  • CDC31 yeast homolog
  • CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
  • centrin, EF-hand protein, 3 (CDC31 yeast homolog)
  • centrin, EF-hand protein, 3
  • centrin-3
  • EF-hand superfamily member
  • MGC12502
  • MGC138245

Background

Centrin 3 is encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14909
Species: Bv, Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4479
Species: Hu
Applications: IHC
NBP1-88213
Species: Hu
Applications: IHC,  IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-13382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00001070-M01
Species: Ch, Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IP, KD, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-05298
Species: Rt
Applications: Flow, Func, IHC, IHC-Fr, IP, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
H00008847-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00010301-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF4888
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB

Publications for Centrin 3 Protein (NBP1-84547PEP) (0)

There are no publications for Centrin 3 Protein (NBP1-84547PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centrin 3 Protein (NBP1-84547PEP) (0)

There are no reviews for Centrin 3 Protein (NBP1-84547PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Centrin 3 Protein (NBP1-84547PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Centrin 3 Products

Research Areas for Centrin 3 Protein (NBP1-84547PEP)

Find related products by research area.

Blogs on Centrin 3

There are no specific blogs for Centrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Centrin 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CETN3