CENTB1 Antibody

Images

 
Western Blot: CENTB1 Antibody [NBP2-84652] - Host: Rabbit. Target Name: ACAP1. Sample Tissue: Human RPMI 8226 Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENTB1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CENTB1. Peptide sequence: IVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ACAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CENTB1 Antibody

  • Arf GAP with coiled coil, ANK repeat and PH domains 1
  • arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
  • ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
  • centaurin, beta 1
  • Centaurin-beta-1
  • CENTB1cnt-b1
  • Cnt-b1
  • KIAA0050centaurin-beta-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP2-24528
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-01763
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-56152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC

Publications for CENTB1 Antibody (NBP2-84652) (0)

There are no publications for CENTB1 Antibody (NBP2-84652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENTB1 Antibody (NBP2-84652) (0)

There are no reviews for CENTB1 Antibody (NBP2-84652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENTB1 Antibody (NBP2-84652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CENTB1 Products

Bioinformatics Tool for CENTB1 Antibody (NBP2-84652)

Discover related pathways, diseases and genes to CENTB1 Antibody (NBP2-84652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENTB1 Antibody (NBP2-84652)

Discover more about diseases related to CENTB1 Antibody (NBP2-84652).
 

Pathways for CENTB1 Antibody (NBP2-84652)

View related products by pathway.

PTMs for CENTB1 Antibody (NBP2-84652)

Learn more about PTMs related to CENTB1 Antibody (NBP2-84652).
 

Research Areas for CENTB1 Antibody (NBP2-84652)

Find related products by research area.

Blogs on CENTB1

There are no specific blogs for CENTB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENTB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAP1