CENPW Antibody

Images

 
Western Blot: CENPW Antibody [NBP1-70496] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPW Antibody Summary

Immunogen
Synthetic peptides corresponding to C6ORF173 The peptide sequence was selected from the N terminal of C6ORF173. Peptide sequence ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C6orf173 and was validated on Western blot.
Theoretical MW
10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CENPW Antibody

  • cancer-up-regulated gene 2 protein
  • centromere protein W

Background

C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4256
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-55474
Species: Hu
Applications: ICC/IF
H00378708-B01P
Species: Hu
Applications: WB, ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-79664
Species: Hu
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-2359
Species: Hu
Applications: WB, IHC, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for CENPW Antibody (NBP1-70496) (0)

There are no publications for CENPW Antibody (NBP1-70496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPW Antibody (NBP1-70496) (0)

There are no reviews for CENPW Antibody (NBP1-70496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPW Antibody (NBP1-70496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPW Products

Bioinformatics Tool for CENPW Antibody (NBP1-70496)

Discover related pathways, diseases and genes to CENPW Antibody (NBP1-70496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPW Antibody (NBP1-70496)

Discover more about diseases related to CENPW Antibody (NBP1-70496).
 

Pathways for CENPW Antibody (NBP1-70496)

View related products by pathway.

Blogs on CENPW

There are no specific blogs for CENPW, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPW Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPW