Recombinant Human CENPA GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CENPA GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-114 of Human CENPA isoform 2, full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CENPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CENPA GST (N-Term) Protein

  • Centromere autoantigen A
  • centromere protein A (17kD)
  • centromere protein ACENP-Acentromere protein A, 17kDa
  • histone H3-like centromeric protein A

Background

CENPA( AAH00881, 1 a.a. - 115 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001059-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002491-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NBP1-85025
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
H00008337-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00378708-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
H00001058-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CENPA Full Length Recombinant Protein (H00001058-P01) (0)

There are no publications for CENPA Full Length Recombinant Protein (H00001058-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPA Full Length Recombinant Protein (H00001058-P01) (0)

There are no reviews for CENPA Full Length Recombinant Protein (H00001058-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPA Full Length Recombinant Protein (H00001058-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CENPA Products

Bioinformatics Tool for CENPA Full Length Recombinant Protein (H00001058-P01)

Discover related pathways, diseases and genes to CENPA Full Length Recombinant Protein (H00001058-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPA Full Length Recombinant Protein (H00001058-P01)

Discover more about diseases related to CENPA Full Length Recombinant Protein (H00001058-P01).
 

Pathways for CENPA Full Length Recombinant Protein (H00001058-P01)

View related products by pathway.

PTMs for CENPA Full Length Recombinant Protein (H00001058-P01)

Learn more about PTMs related to CENPA Full Length Recombinant Protein (H00001058-P01).
 

Research Areas for CENPA Full Length Recombinant Protein (H00001058-P01)

Find related products by research area.

Blogs on CENPA

There are no specific blogs for CENPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CENPA GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPA