CENPA Antibody

Immunocytochemistry/Immunofluorescence: CENPA Antibody [NBP2-57725] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

CENPA Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKLPFSRLAREICVKFTRGVDFNWQAQALLAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CENPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CENPA Antibody

• Centromere autoantigen A
• centromere protein A (17kD)
• centromere protein ACENP-Acentromere protein A, 17kDa
• histone H3-like centromeric protein A

Background

Centromere protein A (CENP-A) is a 17 kD centromere-specific histone variant with 62% amino acids homology to the C-terminal of histone H3. Localized in the centromere, it plays a central role in the centromere-specific chromatin formation. The depletion of histone H3 at the CENP-A binding domain suggests CENP-A to be a possible replacement for histone H3 in the packaging process of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CENPA