Recombinant Human CDR2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDR2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-454 of Human CDR2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CDR2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDR2 Protein

  • CDR62
  • cerebellar degeneration-related protein (62kD)
  • cerebellar degeneration-related protein 2
  • cerebellar degeneration-related protein 2, 62kDa
  • Major Yo paraneoplastic antigen
  • Paraneoplastic cerebellar degeneration-associated antigen
  • PCD17
  • Yo paraneoplastic antigen
  • Yo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57758
Species: Hu
Applications: ICC/IF
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-46466
Species: Hu
Applications: IHC
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001039-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for CDR2 Recombinant Protein (H00001039-P02) (0)

There are no publications for CDR2 Recombinant Protein (H00001039-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2 Recombinant Protein (H00001039-P02) (0)

There are no reviews for CDR2 Recombinant Protein (H00001039-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDR2 Recombinant Protein (H00001039-P02). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
    • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Additional CDR2 Products

Bioinformatics Tool for CDR2 Recombinant Protein (H00001039-P02)

Discover related pathways, diseases and genes to CDR2 Recombinant Protein (H00001039-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDR2 Recombinant Protein (H00001039-P02)

Discover more about diseases related to CDR2 Recombinant Protein (H00001039-P02).
 

Pathways for CDR2 Recombinant Protein (H00001039-P02)

View related products by pathway.

PTMs for CDR2 Recombinant Protein (H00001039-P02)

Learn more about PTMs related to CDR2 Recombinant Protein (H00001039-P02).
 

Research Areas for CDR2 Recombinant Protein (H00001039-P02)

Find related products by research area.

Blogs on CDR2.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

Customers Who Bought This Also Bought

CDR2 Blocking Peptide
NB110-58345PEP
CDR2 Antibody
NB110-58345
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDR2