CDCA7 Recombinant Protein Antigen

Images

 
There are currently no images for CDCA7 Protein (NBP1-82224PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDCA7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCA7.

Source: E.coli

Amino Acid Sequence: PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDCA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82224.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDCA7 Recombinant Protein Antigen

  • cell division cycle associated 7
  • cell division cycle-associated protein 7
  • c-Myc target JPO1
  • FLJ14722
  • FLJ14736
  • JPO1cell division cycle associated protein 7
  • MGC34109
  • Protein JPO1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-46198
Species: Hu
Applications: WB, IHC
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-56500
Species: Hu
Applications: ICC/IF
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
AF5119
Species: Hu
Applications: WB
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85666
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82224PEP
Species: Hu
Applications: AC

Publications for CDCA7 Protein (NBP1-82224PEP) (0)

There are no publications for CDCA7 Protein (NBP1-82224PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDCA7 Protein (NBP1-82224PEP) (0)

There are no reviews for CDCA7 Protein (NBP1-82224PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CDCA7 Protein (NBP1-82224PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDCA7 Products

Bioinformatics Tool for CDCA7 Protein (NBP1-82224PEP)

Discover related pathways, diseases and genes to CDCA7 Protein (NBP1-82224PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDCA7 Protein (NBP1-82224PEP)

Discover more about diseases related to CDCA7 Protein (NBP1-82224PEP).
 

Pathways for CDCA7 Protein (NBP1-82224PEP)

View related products by pathway.

Research Areas for CDCA7 Protein (NBP1-82224PEP)

Find related products by research area.

Blogs on CDCA7

There are no specific blogs for CDCA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
c-Myc Antibody
NB600-335
CDCA7 Antibody
NBP1-82224
CDCA7 Antibody
NBP1-82224

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDCA7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCA7