We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CDCA7 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related CDCA7 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-82224PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CDCA7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCA7.

Source: E. coli

Amino Acid Sequence: PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDCA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82224.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDCA7 Recombinant Protein Antigen

  • cell division cycle associated 7
  • cell division cycle-associated protein 7
  • c-Myc target JPO1
  • FLJ14722
  • FLJ14736
  • JPO1cell division cycle associated protein 7
  • MGC34109
  • Protein JPO1

Background

CDCA7 was identified as a c-Myc responsive gene, and behaves as a direct c-Myc target gene. Overexpression of this gene is found to enhance the transformation of lymphoblastoid cells, and it complements a transformation-defective Myc Box II mutant, suggesting its involvement in c-Myc-mediated cell transformation. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-46198
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-82955
Species: Hu
Applications: WB
NBP1-21374
Species: Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-14936
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
AF5119
Species: Hu
Applications: WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-27194
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
DDX0191P-100
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC,  IHC-P
NBP1-48336
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP3-27122
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85666
Species: Hu
Applications: ICC/IF, WB

Publications for CDCA7 Protein (NBP1-82224PEP) (0)

There are no publications for CDCA7 Protein (NBP1-82224PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDCA7 Protein (NBP1-82224PEP) (0)

There are no reviews for CDCA7 Protein (NBP1-82224PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDCA7 Protein (NBP1-82224PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDCA7 Products

Array NBP1-82224PEP

Research Areas for CDCA7 Protein (NBP1-82224PEP)

Find related products by research area.

Blogs on CDCA7

There are no specific blogs for CDCA7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDCA7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCA7