CDC37 Antibody (3C7)

Images

 
Western Blot: CDC37 Antibody (3C7) [H00011140-M01] - CDC37 monoclonal antibody (M01), clone 3C7. Analysis of CDC37 expression in HL-60.
Immunocytochemistry/ Immunofluorescence: CDC37 Antibody (3C7) [H00011140-M01] - Analysis of monoclonal antibody to CDC37 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDC37 Antibody (3C7) [H00011140-M01] - Analysis of monoclonal antibody to CDC37 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration ...read more
Western Blot: CDC37 Antibody (3C7) [H00011140-M01] - Analysis of CDC37 expression in transfected 293T cell line by CDC37 monoclonal antibody (M01), clone 3C7.Lane 1: CDC37 transfected lysate(44.5 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDC37 Antibody (3C7) Summary

Immunogen
CDC37 (AAH08793, 1 a.a. ~ 379 a.a) full length recombinant protein with GST tag.MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQ FQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAELERL QAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSK SMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRW DDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTAD
Localization
Cytoplasmic and Nuclear
Specificity
CDC37 - CDC37 cell division cycle 37 homolog (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDC37
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publication using
H00011140-M01 in the following applications:

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC37 Antibody (3C7)

  • CDC37 (cell division cycle 37, S. cerevisiae, homolog)
  • CDC37 cell division cycle 37 homolog (S. cerevisiae)
  • CDC37 cell division cycle 37 homolog
  • CDC37A
  • cell division cycle 37 homolog (S. cerevisiae)
  • Hsp90 chaperone protein kinase-targeting subunit
  • hsp90 co-chaperone Cdc37
  • P50CDC37

Background

The protein encoded by this gene is highly similar to Cdc 37, a cell division cycle control protein of Sacchromyces cerevisiae. This protein is a molecular chaperone with specific function in cell signal transduction. It has been shown to form complex with Hsp90 and a variety of protein kinases including CDK4, CDK6, SRC, RAF-1, MOK, as well as eIF2 alpha kinases. It is thought to play a critical role in directing Hsp90 to its target kinases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for CDC37 Antibody (H00011140-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CDC37 Antibody (H00011140-M01) (0)

There are no reviews for CDC37 Antibody (H00011140-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDC37 Antibody (H00011140-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC37 Products

Bioinformatics Tool for CDC37 Antibody (H00011140-M01)

Discover related pathways, diseases and genes to CDC37 Antibody (H00011140-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC37 Antibody (H00011140-M01)

Discover more about diseases related to CDC37 Antibody (H00011140-M01).
 

Pathways for CDC37 Antibody (H00011140-M01)

View related products by pathway.

PTMs for CDC37 Antibody (H00011140-M01)

Learn more about PTMs related to CDC37 Antibody (H00011140-M01).
 

Research Areas for CDC37 Antibody (H00011140-M01)

Find related products by research area.

Blogs on CDC37

There are no specific blogs for CDC37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC37 Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC37
Entrez
OMIM
Uniprot