CD79B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD79B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD79B.
  
  

  Source: E. coli

  Amino Acid Sequence: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD79B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88945.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD79B Recombinant Protein Antigen

• B29
• B29B-cell-specific glycoprotein B29
• B-cell antigen receptor complex-associated protein beta chain
• CD79B antigen (immunoglobulin-associated beta)
• CD79b antigen
• CD79b molecule, immunoglobulin-associated beta
• CD79B
• IGB
• IGBAGM6
• Ig-beta
• Immunoglobulin-associated B29 protein

Background

Murine CD79 is a 23/21 kDa disulfide-linked heterodimer composed of an alpha chain (CD79alpha/mb-1) and a beta chain (CD79b/B29) that associates non-covalently with membrane immunoglobulin (Ig) to form the B cell receptor (BCR) complex. Its expression is restricted to B lymphocytes, first appearing on the surface at the pro-B cell stage prior to productive Ig gene rearrangements and remaining through all stages of B-cell differentiation prior to plasma cells. It has been proposed that the CD79 complex on pro-B cell surfaces may function to induce early B-cell differentiation. (1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD79B