CD300c Antibody (2A10)

Images

 
Sandwich ELISA: CD300c/LMIR2 Antibody (2A10) [H00010871-M01] - Detection limit for recombinant GST tagged CD300C is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD300c Antibody (2A10) Summary

Immunogen
CD300C (NP_006669, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVS
Specificity
CD300C - CD300C antigen
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CD300C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD300c Antibody (2A10)

  • CD300c antigenCMRF35 antigen
  • CD300c molecule
  • CD300c2
  • CLM4
  • CLM-6
  • CMRF35 leukocyte immunoglobulin-like receptor
  • CMRF-35
  • CMRF35A leukocyte immunoglobulin-like receptor
  • CMRF-35A
  • CMRF35ACMRF35A1
  • CMRF35CMRF35-A1
  • CMRF35-like molecule 6
  • IgSF16
  • IGSF16CD300 antigen-like family member C
  • IGSF7
  • Immunoglobulin superfamily member 16
  • LIR
  • LMIR2
  • MAIR-II

Background

The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB24251
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
MAB1186
Species: Mu
Applications: Flow, CyTOF-ready
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
MAB2078
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB2774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-67321
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB6364
Species: Hu
Applications: Flow, CyTOF-ready
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-71703
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA

Publications for CD300c Antibody (H00010871-M01) (0)

There are no publications for CD300c Antibody (H00010871-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300c Antibody (H00010871-M01) (0)

There are no reviews for CD300c Antibody (H00010871-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD300c Antibody (H00010871-M01). (Showing 1 - 1 of 1 FAQ).

  1. Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
    • A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CD300c Products

Bioinformatics Tool for CD300c Antibody (H00010871-M01)

Discover related pathways, diseases and genes to CD300c Antibody (H00010871-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD300c Antibody (H00010871-M01)

Discover more about diseases related to CD300c Antibody (H00010871-M01).
 

Pathways for CD300c Antibody (H00010871-M01)

View related products by pathway.

PTMs for CD300c Antibody (H00010871-M01)

Learn more about PTMs related to CD300c Antibody (H00010871-M01).

Blogs on CD300c

There are no specific blogs for CD300c, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD300c Antibody (2A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CD300C
Entrez
OMIM
Uniprot