Home » CD300c » CD300c Antibodies » CD300c Antibody (2A10)

CD300c Antibody (2A10)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: CD300c/LMIR2 Antibody (2A10) [H00010871-M01] - Detection limit for recombinant GST tagged CD300C is approximately 3ng/ml as a capture antibody.
Sandwich ELISA: CD300c/LMIR2 Antibody (2A10) [H00010871-M01] - Detection limit for recombinant GST tagged CD300C is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CD300c Antibody (2A10) Summary

Immunogen
CD300C (NP_006669, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVS
Specificity
CD300C - CD300C antigen
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CD300C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD300c Antibody (2A10)

  • CD300c antigenCMRF35 antigen
  • CD300c molecule
  • CD300c2
  • CLM4
  • CLM-6
  • CMRF35 leukocyte immunoglobulin-like receptor
  • CMRF-35
  • CMRF35A leukocyte immunoglobulin-like receptor
  • CMRF-35A
  • CMRF35ACMRF35A1
  • CMRF35CMRF35-A1
  • CMRF35-like molecule 6
  • IgSF16
  • IGSF16CD300 antigen-like family member C
  • IGSF7
  • Immunoglobulin superfamily member 16
  • LIR
  • LMIR2
  • MAIR-II

Background

The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ILT3/CD85k/LILRB4
Antibody (293623) [Un ...
MAB24251
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human IL‑3 R alpha /CD123 PE‑conjugated Monoclonal Antibody (Catalog # FAB301P) and either (A) Mouse Anti-Human LILRB4/CD85k/ILT3 Monoclonal Antibody (Catalog # MAB24251) or (B) Mouse IgG2A Isotype Control (Catalog # MAB003) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). 
(2 Reviews)
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
CD300a/LMIR1
Antibody (172224) [Un ...
MAB1186
CD300a/LMIR1 Antibody (172224) [Unconjugated]
(3 Publications)
Species: Mu
Applications: Flow, CyTOF-ready
KIR3DL1 Antibody
(177407)
MAB12251
KIR3DL1 Antibody (177407)
(3 Publications)
Species: Hu
Applications: Flow, CyTOF-ready
ILT4/CD85d/LILRB2
Antibody (287219) [Un ...
MAB2078
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE‑conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Mouse Anti-Human LILRB2/CD85d/ILT4 Monoclonal Antibody (Catalog # MAB2078) or (B) Mouse IgG2A Isotype Control (Catalog # MAB003) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
Recombinant Human LILRB2/CD85d/ILT4 Fc Chimera (Catalog # 2078-T4), immobilized onto a microplate, supports the adhesion of the HSB2 human peripheral blood acute lymphoblastic leukemia cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Human LILRB2/CD85d/ILT4 Fc Chimera (35 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human LILRB2/CD85d/ILT4 Monoclonal Antibody (Catalog # MAB2078). The ND50 is typically0.2-0.8 µg/mL.
(6 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut

CD300f/LMIR3/CD300LF A ...
MAB2774
CD300f/LMIR3 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Rat Anti-Human CD300f/LMIR3 Monoclonal Antibody (Catalog # MAB2774) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC
GEM Antibody
NBP1-58906
Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.
Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.
Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - WB analysis of recombinant p62 protein (immunogen, 74.51 KDa) using SQSTM1/p62 antibody (clone 2C11).
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - WB analysis of p62 in p62 WT and KO mouse hepatocytes and HepG2 cell lysate using anti-p62/SQSTM1 antibody clone 2C11. Sample lane1: p62 +/- mouse hepatocytes, lane 2: p62 -/- mouse hepatocytes, lane3: Wt mouse hepatocytes, lane 4: HepG2 cells. This image is from a verified customer product review.
Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - ICC-IF analysis of SQSTM1 protein in HeLa cell using SQSTM1/p62 antibody (clone 2C11) at 10 ug/ml concentration.
(8 Reviews)
(246 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot: SHP-1 Antibody (SR41-02) [NBP2-67321] - Analysis of SHP1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Raji cell lysate Lane 2: Jurkat cell lysate
Immunocytochemistry/Immunofluorescence: SHP-1 Antibody (SR41-02) [NBP2-67321] - Staining SHP1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: SHP-1 Antibody (SR41-02) [NBP2-67321] - Analysis of paraffin-embedded rat spleen tissue using anti-SHP1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ILT1/CD85h/LILRA2
Antibody (600007)
MAB6364
Human peripheral blood monocytes were stained with Human LILRA2/CD85h/ILT1 Monoclonal Antibody (Catalog # MAB6364, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0101B).
(1 Review)
Species: Hu
Applications: Flow, CyTOF-ready
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: WB, ELISA
NUP62 Antibody
NBP1-31381
Western Blot: NUP62 Antibody [NBP1-31381] - Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and blotted with Nucleoporin p62 antibody diluted by 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Nucleoporin p62 Antibody [NBP1-31381] - Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Nucleoporin p62 protein stained by Nucleoporin p62 antibody diluted at 1:750. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Nucleoporin p62 Antibody [NBP1-31381] - Paraffin-embedded NCIN87 xenograft, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
dynactin 4
Antibody (3G9D7)
NBP2-37399
Western Blot: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Western blot analysis using DCTN4 mouse mAb against Raw264.7 (1) and NIH3T3 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunofluorescence analysis of HepG2 cells using DCTN4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues using DCTN4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBR1 Antibody
NBP1-71703
Western Blot: NBR1 Antibody [NBP1-71703] - The antibody detects HeLa cell NBR1 (about 130 kDa). It detects a 100 kDa band in mouse brain. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: NBR1 Antibody [NBP1-71703] - NBR1 antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: NBR1 Antibody [NBP1-71703] - Staining of NBRI in mouse prostate.
(2 Reviews)
(7 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of GTF2H1 expression in transfected 293T cell line by GTF2H1 monoclonal antibody (M01), clone 1F12-1B5.Lane 1: GTF2H1 transfected lysate(62 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on formalin-fixed paraffin-embedded human testis tissue.Antibody concentration 5 ug/ml.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA

Publications for CD300c Antibody (H00010871-M01) (0)

There are no publications for CD300c Antibody (H00010871-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300c Antibody (H00010871-M01) (0)

There are no reviews for CD300c Antibody (H00010871-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD300c Antibody (H00010871-M01). (Showing 1 - 1 of 1 FAQ).

  1. Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
    • A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CD300c Products

Bioinformatics Tool for CD300c Antibody (H00010871-M01)

Discover related pathways, diseases and genes to CD300c Antibody (H00010871-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD300c Antibody (H00010871-M01)

Discover more about diseases related to CD300c Antibody (H00010871-M01).
 

Pathways for CD300c Antibody (H00010871-M01)

View related products by pathway.

PTMs for CD300c Antibody (H00010871-M01)

Learn more about PTMs related to CD300c Antibody (H00010871-M01).

Blogs on CD300c

There are no specific blogs for CD300c, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD300c Antibody (2A10) and receive a gift card or discount.


Bioinformatics

Gene Symbol CD300C
Entrez
OMIM
Uniprot