CD300c Antibody (2A10) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CD300c Antibody (2A10) - Azide and BSA Free (H00010871-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CD300C (NP_006669, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVS |
| Specificity |
CD300C - CD300C antigen |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CD300C |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CD300c Antibody (2A10) - Azide and BSA Free
Background
The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: EM, ELISA, ICC/IF, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Publications for CD300c Antibody (H00010871-M01) (0)
There are no publications for CD300c Antibody (H00010871-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD300c Antibody (H00010871-M01) (0)
There are no reviews for CD300c Antibody (H00010871-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CD300c Antibody (H00010871-M01). (Showing 1 - 1 of 1 FAQ).
-
Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
- A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.
Secondary Antibodies
| |
Isotype Controls
|
Additional CD300c Products
Research Areas for CD300c Antibody (H00010871-M01)
Find related products by research area.
|
Blogs on CD300c