CD2F-10/SLAMF9 Antibody


Western Blot: SLAMF9 Antibody [NBP1-84593] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: SLAMF9 Antibody [NBP1-84593] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CD2F-10/SLAMF9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF
Specificity of human CD2F-10/SLAMF9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD2F-10/SLAMF9 Protein (NBP1-84593PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD2F-10/SLAMF9 Antibody

  • CD2 family member 10
  • CD2F10
  • CD2F-10
  • CD2F-10MGC88194
  • CD84 homolog 1
  • CD84H1
  • CD84-H1
  • CD84-H1cluster of differentiation 2 antigen family member 10
  • cluster of differentiation 84 homolog 1
  • SF2001
  • signaling lymphocytic activation molecule family member 2001
  • signaling lymphocytic activation molecule family member 9
  • SLAM family member 9
  • SLAMF9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC

Publications for CD2F-10/SLAMF9 Antibody (NBP1-84593) (0)

There are no publications for CD2F-10/SLAMF9 Antibody (NBP1-84593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD2F-10/SLAMF9 Antibody (NBP1-84593) (0)

There are no reviews for CD2F-10/SLAMF9 Antibody (NBP1-84593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD2F-10/SLAMF9 Antibody (NBP1-84593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD2F-10/SLAMF9 Products

Bioinformatics Tool for CD2F-10/SLAMF9 Antibody (NBP1-84593)

Discover related pathways, diseases and genes to CD2F-10/SLAMF9 Antibody (NBP1-84593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CD2F-10/SLAMF9

There are no specific blogs for CD2F-10/SLAMF9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD2F-10/SLAMF9 Antibody and receive a gift card or discount.


Gene Symbol SLAMF9