CCDC28A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC28A Antibody [NBP2-30457] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Immunohistochemistry-Paraffin: CCDC28A Antibody [NBP2-30457] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC28A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSA
Specificity
Specificity of human CCDC28A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC28A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC28A Protein (NBP2-30457PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC28A Antibody

  • C6orf80
  • CCRL1APMGC131913
  • chemokine C-C motif receptor-like 1 adjacent
  • chromosome 6 open reading frame 80
  • coiled-coil domain containing 28A
  • coiled-coil domain-containing protein 28A
  • DKFZp586D0623

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93021
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-34017
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67606
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83211
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30457
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for CCDC28A Antibody (NBP2-30457) (0)

There are no publications for CCDC28A Antibody (NBP2-30457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC28A Antibody (NBP2-30457) (0)

There are no reviews for CCDC28A Antibody (NBP2-30457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC28A Antibody (NBP2-30457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC28A Products

Bioinformatics Tool for CCDC28A Antibody (NBP2-30457)

Discover related pathways, diseases and genes to CCDC28A Antibody (NBP2-30457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC28A Antibody (NBP2-30457)

Discover more about diseases related to CCDC28A Antibody (NBP2-30457).

Blogs on CCDC28A

There are no specific blogs for CCDC28A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC28A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC28A
Uniprot