CCDC28A Antibody

Images

 
Western Blot: CCDC28A Antibody [NBP1-79581] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity Hu, Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC28A Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human CCDC28AThe immunogen for this antibody is CCDC28A. Peptide sequence ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE.
Predicted Species
Human (100%), Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC28A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CCDC28A and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCDC28A Antibody

  • C6orf80
  • CCRL1APMGC131913
  • chemokine C-C motif receptor-like 1 adjacent
  • chromosome 6 open reading frame 80
  • coiled-coil domain containing 28A
  • coiled-coil domain-containing protein 28A
  • DKFZp586D0623

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93325
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93021
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-34017
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83211
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-79581
Species: Hu, Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for CCDC28A Antibody (NBP1-79581) (0)

There are no publications for CCDC28A Antibody (NBP1-79581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC28A Antibody (NBP1-79581) (0)

There are no reviews for CCDC28A Antibody (NBP1-79581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC28A Antibody (NBP1-79581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC28A Products

Bioinformatics Tool for CCDC28A Antibody (NBP1-79581)

Discover related pathways, diseases and genes to CCDC28A Antibody (NBP1-79581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC28A Antibody (NBP1-79581)

Discover more about diseases related to CCDC28A Antibody (NBP1-79581).

Blogs on CCDC28A

There are no specific blogs for CCDC28A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC28A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC28A
Uniprot