Home » CBX7 » CBX7 Research Products » CBX7 Antibody

CBX7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CBX7 Antibody [H00023492-B01P] - Analysis of CBX7 expression in Hela S3 NE.
Western Blot: CBX7 Antibody [H00023492-B01P] - Analysis of CBX7 expression in Hela S3 NE.
Western Blot: CBX7 Antibody [H00023492-B01P] - Analysis of CBX7 expression in transfected 293T cell line by CBX7 polyclonal antibody. Lane 1: CBX7 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related CBX7 Primary Antibodies

Order Details


    • Catalog Number
      H00023492-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CBX7 Antibody Summary

Immunogen
CBX7 (NP_783640.1, 1 a.a. - 251 a.a.) full-length human protein. MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Specificity
CBX7 - chromobox homolog 7,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CBX7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBX7 Antibody

  • chromobox homolog 7
  • chromobox protein homolog 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
PRC1 Antibody
NBP1-88856
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining in human testis and pancreas tissues.. Corresponding PRC1 RNA-seq data are presented for the same tissues.
Western Blot: PRC1 Antibody [NBP1-88856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining of human cerebral cortex shows moderate positivity in nuclear membrane in neurons.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
CBX4 Antibody
(6C5G3)
NBP2-52432
Western Blot: CBX4 Antibody (6C5G3) [NBP2-52432] - Analysis using CBX4 mAb against human CBX4 (AA: 397-514) recombinant protein. (Expected MW is 43.3 kDa)
Immunohistochemistry-Paraffin: CBX4 Antibody (6C5G3) [NBP2-52432] - Analysis of rectum cancer tissues using CBX4 mouse mAb with DAB staining.
Flow Cytometry: CBX4 Antibody (6C5G3) [NBP2-52432] - Flow cytometric analysis of Hela cells using CBX4 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Cbx2 Antibody
NBP2-47524
Immunocytochemistry/Immunofluorescence: Cbx2 Antibody [NBP2-47524] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CBX1 Antibody
NBP2-98756
Western Blot: CBX1 Antibody [NBP2-98756] - Anti-CBX1 rabbit polyclonal antibody at 1:500 dilution. Lane A: HeLa Whole Cell Lysate. Lane B: MCF7 Whole Cell Lysate. Lane C: A431 Whole Cell Lysate. Lane D: 293T Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa
Immunocytochemistry/Immunofluorescence: CBX1 Antibody [NBP2-98756] - Immunofluorescence staining of CBX1 in HeLa cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human CBX1 polyclonal antibody (dilution ratio 1:1000) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG Secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Nucleus.
Immunohistochemistry-Paraffin: CBX1 Antibody [NBP2-98756] - Immunochemical staining CBX1 in mouse testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CBX6 Antibody
NBP1-28731
Western Blot: CBX6 Antibody [NBP1-28731] - Detection of human and mouse CBX6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CBX6 antibody NBP1-28731 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: CBX6 Antibody [NBP1-28731] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-CBX6 (NBP1-28731). Detection: DAB
Immunoprecipitation: CBX6 Antibody [NBP1-28731] - Detection of human CBX6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CBX6 antibody NBP1-28731 used for IP at 3 ug per reaction. CBX6 was also immunoprecipitated by another rabbit anti-CBX6 antibody. For blotting immunoprecipitated CBX6, NBP1-28731 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
BMI-1 Antibody
(LLBmi1-1)
NBP1-96140
Western Blot: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - BMI-1 expression in human cell lines (MCF-7, K562 and A459). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Bmi1 Antibody (LLBmi1-1) [NBP1-96140] - Bmi1 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 [LLBmi1-1] Antibody NBP1-96140 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IP, Flow-IC
Cbx8 Antibody
NBP1-83224
Western Blot: Cbx8 Antibody [NBP1-83224] - Analysis in human cell line A-549.
Immunocytochemistry/Immunofluorescence: Cbx8 Antibody [NBP1-83224] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cbx8 Antibody [NBP1-83224] - Analysis in human testis and liver tissues. Corresponding CBX8 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
Immunocytochemistry/Immunofluorescence: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
(2 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
RING1 Antibody
(8C12F4)
NBP2-37370
Western Blot: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis using Ring1 mouse mAb against MOLT-4 (1), LNCaP (2), Hela (3), HEK-293 (4) and Jurkat (5) cell lysate.
Immunohistochemistry-Paraffin: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis of rectum cancer tissues using Ring1 mouse mAb with DAB staining.
Flow Cytometry: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis of Hela cells using Ring1 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Histone
Deacetylase 2/HDAC2 A ...
NBP2-67451
Western Blot: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of HDAC2 on different lysates using anti-HDAC2 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: K562
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Staining HDAC2 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of paraffin-embedded rat spinal cord tissue using anti-HDAC2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
RIP140 Antibody
NBP2-13674
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
p15INK4b/CDKN2B
Antibody (651308) [Un ...
MAB6798
Western blot shows lysates of 293T human embryonic kidney cell line and HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for p15INK4b/CDKN2B at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p15INK4b/CDKN2B was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC

NK3R/TACR3/Neurokinin ...
NB300-102
NK3R/TACR3/Neurokinin B Receptor Antibody
(32 Publications)
Species: Mu, Rt, Gp, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
COMT Antibody
NB100-41387
Western Blot: COMT Antibody [NB100-41387] - Staining of human testis lysate (35ug protein in RIPA buffer) with Goat Anti-COMT (internal) (0.03ug/ml). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: COMT Antibody [NB100-41387] - staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: COMT Antibody [NB100-41387] - (4ug/ml) staining of paraffin embedded Human Cerebellum. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
Cytokeratin 17
Antibody (E3 (same as ...
NBP2-29421
Western Blot: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Analysis of Cytokeratin 17 in human HeLa lysate using Cytokeratin 17 E3 antibody at 3 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
(2 Publications)
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CBX7 Antibody (H00023492-B01P) (0)

There are no publications for CBX7 Antibody (H00023492-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX7 Antibody (H00023492-B01P) (0)

There are no reviews for CBX7 Antibody (H00023492-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBX7 Antibody (H00023492-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CBX7 Products

Bioinformatics Tool for CBX7 Antibody (H00023492-B01P)

Discover related pathways, diseases and genes to CBX7 Antibody (H00023492-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBX7 Antibody (H00023492-B01P)

Discover more about diseases related to CBX7 Antibody (H00023492-B01P).
 

Pathways for CBX7 Antibody (H00023492-B01P)

View related products by pathway.

PTMs for CBX7 Antibody (H00023492-B01P)

Learn more about PTMs related to CBX7 Antibody (H00023492-B01P).

Blogs on CBX7

There are no specific blogs for CBX7, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBX7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CBX7
Entrez
Uniprot