CBX7 Antibody

Images

 
Western Blot: CBX7 Antibody [H00023492-B01P] - Analysis of CBX7 expression in Hela S3 NE.
Western Blot: CBX7 Antibody [H00023492-B01P] - Analysis of CBX7 expression in transfected 293T cell line by CBX7 polyclonal antibody. Lane 1: CBX7 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related CBX7 Primary Antibodies

Order Details


    • Catalog Number
      H00023492-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CBX7 Antibody Summary

Immunogen
CBX7 (NP_783640.1, 1 a.a. - 251 a.a.) full-length human protein. MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Specificity
CBX7 - chromobox homolog 7,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CBX7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBX7 Antibody

  • chromobox homolog 7
  • chromobox protein homolog 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-98756
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-28731
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-96140
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IP, Flow-IC
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13674
Species: Hu
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB300-102
Species: Mu, Rt, Gp, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CBX7 Antibody (H00023492-B01P) (0)

There are no publications for CBX7 Antibody (H00023492-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX7 Antibody (H00023492-B01P) (0)

There are no reviews for CBX7 Antibody (H00023492-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBX7 Antibody (H00023492-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CBX7 Products

Bioinformatics Tool for CBX7 Antibody (H00023492-B01P)

Discover related pathways, diseases and genes to CBX7 Antibody (H00023492-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBX7 Antibody (H00023492-B01P)

Discover more about diseases related to CBX7 Antibody (H00023492-B01P).
 

Pathways for CBX7 Antibody (H00023492-B01P)

View related products by pathway.

PTMs for CBX7 Antibody (H00023492-B01P)

Learn more about PTMs related to CBX7 Antibody (H00023492-B01P).

Blogs on CBX7

There are no specific blogs for CBX7, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX7
Entrez
Uniprot