Recombinant Human Cav1.4 Protein

Images

 
SDS-Page: Recombinant Human Cav1.4 Protein [H00000778-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cav1.4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CACNA1F partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

Protein/Peptide Type
Partial Recombinant Protein
Gene
CACNA1F

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cav1.4 Protein

  • AIED
  • CACNAF1
  • calcium channel, voltage-dependent, L type, alpha 1F subunit
  • Cav1.4
  • Cav1.4alpha1
  • COD4
  • CORDX
  • CORDX3CSNB2
  • CSNB2AAland island eye disease (Forsius-Eriksson ocular albinism, ocular albinismtype 2)
  • CSNBX2
  • JM8
  • JMC8
  • OA2COD3
  • voltage-dependent L-type calcium channel subunit alpha-1F
  • Voltage-gated calcium channel subunit alpha Cav1.4

Background

CACNA1F - calcium channel, voltage-dependent, alpha 1F subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-91742
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14066
Species: Hu
Applications: IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Cav1.4 Partial Recombinant Protein (H00000778-Q01) (0)

There are no publications for Cav1.4 Partial Recombinant Protein (H00000778-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav1.4 Partial Recombinant Protein (H00000778-Q01) (0)

There are no reviews for Cav1.4 Partial Recombinant Protein (H00000778-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cav1.4 Partial Recombinant Protein (H00000778-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cav1.4 Products

Bioinformatics Tool for Cav1.4 Partial Recombinant Protein (H00000778-Q01)

Discover related pathways, diseases and genes to Cav1.4 Partial Recombinant Protein (H00000778-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cav1.4 Partial Recombinant Protein (H00000778-Q01)

Discover more about diseases related to Cav1.4 Partial Recombinant Protein (H00000778-Q01).
 

Pathways for Cav1.4 Partial Recombinant Protein (H00000778-Q01)

View related products by pathway.

Research Areas for Cav1.4 Partial Recombinant Protein (H00000778-Q01)

Find related products by research area.

Blogs on Cav1.4

There are no specific blogs for Cav1.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cav1.4 Antibody
H00000778-A01
mGluR6 Antibody
NB300-189

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cav1.4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1F