Cav1.4 Antibody

Images

 
Western Blot: Cav1.4 Antibody [H00000778-A01] - Detection against Immunogen (37.11 KDa).

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cav1.4 Antibody Summary

Immunogen
CACNA1F (NP_005174 1878 a.a. - 1977 a.a.) partial recombinant protein with GST tag. LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
Specificity
CACNA1F - calcium channel, voltage-dependent, alpha 1F subunit
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CACNA1F
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
ICC/IF usage reported in scientific literature (PMID: 24696145).
Publications
Read Publication using
H00000778-A01 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24696145).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cav1.4 Antibody

  • AIED
  • CACNAF1
  • calcium channel, voltage-dependent, L type, alpha 1F subunit
  • Cav1.4
  • Cav1.4alpha1
  • COD4
  • CORDX
  • CORDX3CSNB2
  • CSNB2AAland island eye disease (Forsius-Eriksson ocular albinism, ocular albinismtype 2)
  • CSNBX2
  • JM8
  • JMC8
  • OA2COD3
  • voltage-dependent L-type calcium channel subunit alpha-1F
  • Voltage-gated calcium channel subunit alpha Cav1.4

Background

This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-91742
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14066
Species: Hu
Applications: IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Cav1.4 Antibody (H00000778-A01)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Cav1.4 Antibody (H00000778-A01) (0)

There are no reviews for Cav1.4 Antibody (H00000778-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cav1.4 Antibody (H00000778-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cav1.4 Products

Bioinformatics Tool for Cav1.4 Antibody (H00000778-A01)

Discover related pathways, diseases and genes to Cav1.4 Antibody (H00000778-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cav1.4 Antibody (H00000778-A01)

Discover more about diseases related to Cav1.4 Antibody (H00000778-A01).
 

Pathways for Cav1.4 Antibody (H00000778-A01)

View related products by pathway.

Research Areas for Cav1.4 Antibody (H00000778-A01)

Find related products by research area.

Blogs on Cav1.4

There are no specific blogs for Cav1.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cav1.4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1F
Entrez
OMIM
Uniprot