Casein Kinase 1 gamma 2 Antibody [FITC]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: FITC

Casein Kinase 1 gamma 2 Antibody [FITC] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 316-415 of human Casein Kinase 1 gamma 2 (NP_001310.3).
  
  Sequence:
  FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK1G2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for Casein Kinase 1 gamma 2 Antibody [FITC]

• Casein Kinase 1 gamma 2
• casein kinase 1 isoform gamma-2
• casein kinase 1, gamma 2
• casein kinase I isoform gamma-2
• CK1G2
• CKI-gamma 2
• CSNK1G2
• EC 2.7.11
• EC 2.7.11.1

Background

Casein kinase 1 gamma 2 (CSNK1G2) is a serine/threonine protein kinase which shows preferential utilization of acidic proteins such as caseins as a substrate. It can phosphorylate a large number of proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK1G2