CASC3 Antibody

Images

 
Immunohistochemistry-Paraffin: CASC3 Antibody [NBP1-88515] - Staining of human testis shows strong cytoplasmic positivity in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CASC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CASC3 Protein (NBP1-88515PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CASC3 Antibody

  • barentsz
  • Btz
  • cancer susceptibility candidate 3
  • Cancer susceptibility candidate gene 3 protein
  • metastatic lymph node 51
  • Metastatic lymph node gene 51 protein
  • MLN 51
  • MLN51BTZ
  • Protein barentsz
  • protein CASC3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33202
Species: Hu, Mu
Applications: WB, IP
NB100-368
Species: Hu
Applications: WB
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for CASC3 Antibody (NBP1-88515) (0)

There are no publications for CASC3 Antibody (NBP1-88515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CASC3 Antibody (NBP1-88515) (0)

There are no reviews for CASC3 Antibody (NBP1-88515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CASC3 Antibody (NBP1-88515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CASC3 Products

Bioinformatics Tool for CASC3 Antibody (NBP1-88515)

Discover related pathways, diseases and genes to CASC3 Antibody (NBP1-88515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CASC3 Antibody (NBP1-88515)

Discover more about diseases related to CASC3 Antibody (NBP1-88515).
 

Pathways for CASC3 Antibody (NBP1-88515)

View related products by pathway.

Research Areas for CASC3 Antibody (NBP1-88515)

Find related products by research area.

Blogs on CASC3

There are no specific blogs for CASC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CASC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASC3